Embl file example: ID Corynebacteriumpseudotuberculosis1002-completegenome; SV 1; linear; unassigned DNA; STD; UNC; 2335113 BP.
XX
AC Corynebacteriumpseudotuberculosis1002-completegenome;
XX
DE Corynebacterium pseudotuberculosis 1002
XX
XX
OS Corynebacterium pseudotuberculosis 1002
OC Bacteria; Terrabacteria group; Actinobacteria; Actinobacteria;
OC Corynebacteriales; Corynebacteriaceae; Corynebacterium.
XX
FH Key Location/Qualifiers
FH
FT source 1..2335113
FT /mol_type="genomic DNA"
FT /db_xref="taxon:1719"
FT /genome_md5=""
FT /project="x"
FT /genome_id="1719.1041"
FT /organism="Corynebacterium pseudotuberculosis 1002"
FT CDS 1..1812
FT /db_xref="SEED:fig|1719.1041.peg.1"
FT /translation="MSEAPSTWNERWQEVTNELLSQSQDPESGISITRQQSAYLRLVKP
FT VAFVEGIAVLSVPHARAKKEIETTLGPVITEVLSRRLGRQYSLAVSVHAPEENPEVSSA
FT TPDAVSDYQEQSAVSGQYGATSANADFQNQQSTIYRKPQESQYPVTFGASSYGNEKYQE
FT NSQDQGISHHPYGFNEAQRIASSASHAVPQSGSELLHDPVHTRRTDAALDQNYPGNTGG
FT WRTEHIQEPMPTEQIPSGTPRTREQPSFNPDRALALNPHYTFDSYVVSDSNKLPCSAAI
FT AVAEKPARAYNPLFIWGDSGLGKTHLMHAVGNYAQYLNPRLRIKYVSSEEFTNEYINSV
FT RDDRQEAFKRKYRELDILMVDDIQFLQGKEGTQEEFFHTFNALYQANKQIVLSSDRPPK
FT QLTTLEDRLRTRFQAGLIADIYPPDLETRIAILMKKAASESIVADREAIELIASRFNTS
FT IRELEGAFIRVSAYASLMSPDKGKHRVDLRIAEKALEDMMPEQANEEITATTILAATAE
FT YFEMDVNALKGSGKTRAVAHARQLAMYLCRELTDLSLPKIGEQFGGKDHTTVMYADRKV
FT RKEITEKKETYDEIQLLTQQIKSSSRG"
FT /product="Chromosomal replication initiator protein DnaA"
FT /transl_table=11